Foxd2 Rabbit Polyclonal Antibody

• Catalog Number: orb329893
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Foxd2
• Target: Foxd2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse Foxd2
• Protein Sequence: Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC
• UniProt ID: O35392
• MW: 49
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Mf2 antibody, anti AI426778 antibody
• Research Area: Cell Biology, Epigenetics & Chromatin, Stem Cell &
• Note: For research use only
• NCBI: NP_032619

WB Suggested Anti-Foxd2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Thymus.