FOXC2 monoclonal antibody (M04), clone 1A8

• Catalog Number: orb2293010
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant FOXC2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A8
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL
• NCBI: NP_005242
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FOXC2 is 3 ng/ml as a capture antibody.

FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in 293.

FOXC2 monoclonal antibody (M04), clone 1A8. Western Blot analysis of FOXC2 expression in NIH/3T3.

Western Blot detection against Immunogen (37.11 KDa).