FOXC2 monoclonal antibody (M02), clone 2H3

• Catalog Number: orb2293011
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXC2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2H3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Lambda
• Immunogen: FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
• NCBI: NP_005242.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FOXC2 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to FOXC2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]

Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]

Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (34.65 KDa).