You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292799 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FOXA1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 2D7 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004487 |
Western Blot detection against Immunogen (37.4 KDa).
Detection limit for recombinant GST tagged FOXA1 is approximately 0.03 ng/ml as a capture antibody.
FOXA1 monoclonal antibody (M01), clone 2D7. Western Blot analysis of FOXA1 expression in HepG2.
Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody (M01), clone 2D7. Lane 1: FOXA1 transfected lysate (49.1 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody (M01), clone 2D7 (Cat # orb2292799). GAPDH (36.1 kDa) used as specificity and loading control.