FMRP/FMR1 Antibody

• Catalog Number: orb316566
• Category: Antibodies
• Description: FMRP/FMR1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 71174 MW
• UniProt ID: Q06787
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Fragile X mental retardation protein 1;FMRP;Protei
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of FMRP/FMR1 using anti-FMRP/FMR1 antibody.Lane 1:human HeLa cell;2:human 293T cell;3:human Jurkat cell;4:human K562 cell;5:rat brain tissue;6:rat liver tissue;7:mouse brain tissue;8:mouse liver tissue.

IF analysis of FMRP/FMR1 using anti-FMRP/FMR1 antibody. FMRP/FMR1 was detected in an immunocytochemical section of HeLa cells.

IHC analysis of FMRP/FMR1 using anti-FMRP/FMR1 antibody. FMRP/FMR1 was detected in a paraffin-embedded section of human seminoma testis tissue.