FLVCR monoclonal antibody (M05), clone 4B2

• Catalog Number: orb2291219
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FLVCR.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
• NCBI: NP_054772
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FLVCR1 is 0.3 ng/ml as a capture antibody.

Western Blot analysis of FLVCR expression in transfected 293T cell line by FLVCR monoclonal antibody (M05), clone 4B2. Lane 1: FLVCR transfected lysate(59.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of FLVCR over-expressed 293 cell line, cotransfected with FLVCR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FLVCR monoclonal antibody (M05), clone 4B2 (Cat # orb2291219). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (34.87 KDa).