You have no items in your shopping cart.
Cart summary
FkpA Protein, Aeromonas hydrophila, Recombinant (His & SUMO)
Catalog Number: orb1979880
| Catalog Number | orb1979880 |
|---|---|
| Category | Proteins |
| Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FkpA probably acts in the folding of extracytoplasmic proteins. FkpA Protein, Aeromonas hydrophila, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 42.7 kDa and the accession number is O08437. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 42.7 kDa (predicted) |
| UniProt ID | O08437 |
| Protein Sequence | CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK |
| Expression System | E. coli |
| Biological Origin | Aeromonas hydrophila |
| Biological Activity | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FkpA probably acts in the folding of extracytoplasmic proteins. FkpA Protein, Aeromonas hydrophila, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 42.7 kDa and the accession number is O08437. |
| Expression Region | 21-268 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
