FIV (isolate Petaluma) Gag polyprotein (His & Myc)

• Catalog Number: orb1979154
• Category: Proteins
• Description: Matrix protein p15 forms the outer shell of the core of the virus, lining the inner surface of the viral membrane.; Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.; Nucleocapsid protein p13 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers. FIV (isolate Petaluma) Gag polyprotein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 22.1 kDa and the accession number is P16087.
• Tag: N-10xHis, C-Myc
• Purity: 98.00%
• MW: 22.1 kDa (predicted)
• UniProt ID: P16087
• Protein Sequence: MGNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY
• Expression System: E. coli
• Biological Origin: FIV
• Biological Activity: Matrix protein p15 forms the outer shell of the core of the virus, lining the inner surface of the viral membrane.; Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.; Nucleocapsid protein p13 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers. FIV (isolate Petaluma) Gag polyprotein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 22.1 kDa and the accession number is P16087.
• Expression Region: 1-135 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.