FGR monoclonal antibody (M02), clone 3B11

• Catalog Number: orb2293043
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGR.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B11
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: FGR (AAH64382, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
• NCBI: AAH64382
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGR is approximately 0.1 ng/ml as a capture antibody.

FGR monoclonal antibody (M02), clone 3B11 Western Blot analysis of FGR expression in HeLa.

FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in PC-12.

FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7.

Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (35.53 KDa).