You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293044 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FGR. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3G10 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | FGR (AAH64382, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA |
NCBI | AAH64382 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged FGR is approximately 0.3 ng/ml as a capture antibody.
FGR monoclonal antibody (M01), clone 3G10 Western Blot analysis of FGR expression in HeLa.
FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in PC-12.
FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in Raw 264.7.
Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (35.53 KDa).