FGG monoclonal antibody (M01J), clone 1F2

• Catalog Number: orb2293047
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGG.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F2
• Tested applications: ELISA, IHC-P, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FGG (AAH07044, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD
• NCBI: AAH07044
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGG is 0.03 ng/ml as a capture antibody.

FGG monoclonal antibody (M01J), clone 1F2. Western Blot analysis of FGG expression in HepG2.

Immunoperoxidase of monoclonal antibody to FGG on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between ICAM1 and FGG. HeLa cells were stained with anti-ICAM1 rabbit purified polyclonal 1:1200 and anti-FGG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.63 KDa).