FGFR2 monoclonal antibody (M01), clone 1G3

• Catalog Number: orb2293049
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGFR2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G3
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: FGFR2 (AAH39243, 621 a.a. ~ 723 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
• NCBI: AAH39243
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGFR2 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to FGFR2 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. [antibody concentration 5 ug/ml]

Western Blot analysis of FGFR2 expression in transfected 293T cell line by FGFR2 monoclonal antibody (M01), clone 1G3. Lane 1: FGFR2 transfected lysate (Predicted MW: 92 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.07 KDa).