FGF5 monoclonal antibody (M01), clone 1B4

• Catalog Number: orb2293061
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGF5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B4
• Tested applications: ELISA, IP, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FGF5 (NP_004455.2, 159 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
• NCBI: NP_004455.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGF5 is 3 ng/ml as a capture antibody.

FGF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of FGF5 expression in human colon.

Immunoprecipitation of FGF5 transfected lysate using anti-FGF5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF5 MaxPab rabbit polyclonal antibody.

Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF5. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).