FGF12 monoclonal antibody (M10), clone 1D9

• Catalog Number: orb2293057
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant FGF12.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FGF12 (AAH22524, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
• NCBI: AAH22524
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGF12 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to FGF12 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]

Western Blot analysis of FGF12 expression in transfected 293T cell line by FGF12 monoclonal antibody (M10), clone 1D9. Lane 1: FGF12 transfected lysate (27.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (45.65 KDa).