FGF1 monoclonal antibody (M02), clone 2E12

• Catalog Number: orb2293064
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E12
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• NCBI: AAH32697
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FGF1 is approximately 10 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to FGF1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to FGF1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Immunoprecipitation of FGF1 transfected lysate using anti-FGF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of FGF1 expression in transfected 293T cell line by FGF1 monoclonal antibody (M02), clone 2E12. Lane 1: FGF1 transfected lysate (17.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).