FGF1 monoclonal antibody (M01), clone 3F5

• Catalog Number: orb2293065
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FGF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F5
• Tested applications: ELISA, IF, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• NCBI: AAH32697
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (37.73 KDa).

Immunofluorescence of monoclonal antibody to FGF1 on HeLa cell. [antibody concentration 10 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF1. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).