FCGR2B monoclonal antibody (M01A), clone 2E10

• Catalog Number: orb2293079
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FCGR2B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FCGR2B (AAH31992, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS
• NCBI: AAH31992
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FCGR2B monoclonal antibody (M01A), clone 2E10 Western Blot analysis of FCGR2B expression in K-562.

Western Blot analysis of FCGR2B expression in transfected 293T cell line by FCGR2B monoclonal antibody (M01A), clone 2E10. Lane 1: FCGR2B transfected lysate (34 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).