FCGR1A monoclonal antibody (M01), clone 1D3

• Catalog Number: orb2293081
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FCGR1A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D3
• Tested applications: ELISA, PLA
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: FCGR1A (NP_000557, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFT
• NCBI: NP_000557
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FCGR1A is approximately 1 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between FCGR3A and FCGR1A. HeLa cells were stained with anti-FCGR3A rabbit purified polyclonal 1:1200 and anti-FCGR1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).