FBXW7 monoclonal antibody (M02), clone 3D1

• Catalog Number: orb2291039
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FBXW7.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 3D1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_361014

Detection limit for recombinant GST tagged FBXW7 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to FBXW7 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (37.73 KDa).