C5orf4 Rabbit Polyclonal Antibody

SKU: orb578565

Description

Rabbit polyclonal antibody to C5orf4

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf4
• Target: FAXDC2
• Protein Sequence: Synthetic peptide located within the following region: MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C5orf4

Human kidney

WB Suggested Anti-C5orf4 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that FAXDC2 is expressed in HepG2.

Quick Database Links

Gene Symbol

FAXDC2

UniProt

Q96IV6

RefSeq (Protein):NP_115761