FAU monoclonal antibody (M03), clone 3C10

• Catalog Number: orb2293093
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant FAU.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C10
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: FAU (AAH33877, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
• NCBI: AAH33877
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to FAU on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of FAU expression in transfected 293T cell line by FAU monoclonal antibody (M03), clone 3C10. Lane 1: FAU transfected lysate (14.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (40.37 KDa).