You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293099 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FAP. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E5 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS |
NCBI | AAH26250 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (36.74 KDa).
Detection limit for recombinant GST tagged FAP is approximately 0.1 ng/ml as a capture antibody.
FAP monoclonal antibody (M01), clone 1E5 Western Blot analysis of FAP expression in HepG2.
Immunoprecipitation of FAP transfected lysate using anti-FAP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FAP MaxPab rabbit polyclonal antibody.
Western Blot analysis of FAP expression in transfected 293T cell line by FAP monoclonal antibody (M01), clone 1E5. Lane 1: FAP transfected lysate (87.7 KDa). Lane 2: Non-transfected lysate.