You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
FAP monoclonal antibody (M01), clone 1E5
Catalog Number: orb2293099
| Catalog Number | orb2293099 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant FAP. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS |
| Tested applications | ELISA, IP, WB |
| Clone Number | 1E5 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH26250 |
Western Blot detection against Immunogen (36.74 KDa).
Detection limit for recombinant GST tagged FAP is approximately 0.1 ng/ml as a capture antibody.
FAP monoclonal antibody (M01), clone 1E5 Western Blot analysis of FAP expression in HepG2.
Immunoprecipitation of FAP transfected lysate using anti-FAP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FAP MaxPab rabbit polyclonal antibody.
Western Blot analysis of FAP expression in transfected 293T cell line by FAP monoclonal antibody (M01), clone 1E5. Lane 1: FAP transfected lysate (87.7 KDa). Lane 2: Non-transfected lysate.
