You have no items in your shopping cart.
Cart summary
FAM3B Protein, Human, Recombinant (His & Myc)
Catalog Number: orb2816127
| Catalog Number | orb2816127 |
|---|---|
| Category | Proteins |
| Description | FAM3B Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is P58499. |
| Tag | N-10xHis, C-Myc |
| MW | 30.3 kDa (Predicted) |
| UniProt ID | P58499 |
| Protein Sequence | ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 30-235 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
