F9 monoclonal antibody (M01), clone 2C9

• Catalog Number: orb2293135
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant F9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C9
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: F9 (NP_000124, 96 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT
• NCBI: NP_000124
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged F9 is approximately 0.1 ng/ml as a capture antibody.

Immunoprecipitation of F9 transfected lysate using anti-F9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with F9 MaxPab rabbit polyclonal antibody.

Western Blot analysis of F9 expression in transfected 293T cell line by F9 monoclonal antibody (M01), clone 2C9. Lane 1: F9 transfected lysate (51.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of F9 over-expressed 293 cell line, cotransfected with F9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with F9 monoclonal antibody (M01), clone 2C9 (Cat # orb2293135). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.19 KDa).