F2R monoclonal antibody (M01), clone 2C5

• Catalog Number: orb2293143
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant F2R.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C5
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: F2R (NP_001983.1, 42 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
• NCBI: NP_001983.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged F2R is 0.1 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between MMP1 and F2R. HeLa cells were stained with anti-MMP1 rabbit purified polyclonal 1:1200 and anti-F2R mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (32.45 KDa).