F11 monoclonal antibody (M01), clone 2H8

• Catalog Number: orb2293131
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant F11.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2H8
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: F11 (NP_000119, 286 a.a. ~ 385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK
• NCBI: NP_000119
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (36.74 KDa).

Detection limit for recombinant GST tagged F11 is approximately 10 ng/ml as a capture antibody.

Immunoprecipitation of F11 transfected lysate using anti-F11 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with F11 MaxPab rabbit polyclonal antibody.

Western Blot analysis of F11 expression in transfected 293T cell line by F11 monoclonal antibody (M01), clone 2H8. Lane 1: F11 transfected lysate (70.1 KDa). Lane 2: Non-transfected lysate.