EYA2 monoclonal antibody (M04), clone 2F8

• Catalog Number: orb2293149
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EYA2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F8
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EYA2 (NP_742108, 164 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYG
• NCBI: NP_742108
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EYA2 monoclonal antibody (M04), clone 2F8 Western Blot analysis of EYA2 expression in IMR-32.

Immunofluorescence of monoclonal antibody to EYA2 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 monoclonal antibody (M04), clone 2F8. Lane 1: EYA2 transfected lysate (59.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.99 KDa).