You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293149 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EYA2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F8 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | EYA2 (NP_742108, 164 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | PASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYG |
NCBI | NP_742108 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EYA2 monoclonal antibody (M04), clone 2F8 Western Blot analysis of EYA2 expression in IMR-32.
Immunofluorescence of monoclonal antibody to EYA2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of EYA2 expression in transfected 293T cell line by EYA2 monoclonal antibody (M04), clone 2F8. Lane 1: EYA2 transfected lysate (59.2 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.99 KDa).