You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
EYA1 polyclonal antibody (A01)
Catalog Number: orb2293150
| Catalog Number | orb2293150 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant EYA1. |
| Clonality | Polyclonal |
| Species/Host | Mouse |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | 50 % glycerol |
| Immunogen | EYA1 (NP_000494, 100 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF |
| Tested applications | ELISA, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_000494 |
EYA1 polyclonal antibody (A01), Western Blot analysis of EYA1 expression in Jurkat.
Western Blot detection against Immunogen (33.92 KDa).
