EXOC4 monoclonal antibody (M06), clone 4F1

• Catalog Number: orb2290895
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EXOC4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F1
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: EXOC4 (NP_068579, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
• NCBI: NP_068579
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EXOC4 is approximately 0.1 ng/ml as a capture antibody.

EXOC4 monoclonal antibody (M06), clone 4F1 Western Blot analysis of EXOC4 expression in Hela S3 NE.

EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in NIH/3T3.

EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in PC-12.

EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in Raw 264.7.

Western Blot detection against Immunogen (37.73 KDa).