EWSR1 monoclonal antibody (M01), clone 5C10

• Catalog Number: orb2293155
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EWSR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5C10
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: EWSR1 (NP_005234, 358 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
• NCBI: NP_005234
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EWSR1 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to EWSR1 on formalin-fixed paraffin-embedded human urinary bladder. [antibody concentration 3 ug/ml]

Western Blot analysis of EWSR1 expression in transfected 293T cell line by EWSR1 monoclonal antibody (M01), clone 5C10. Lane 1: EWSR1 transfected lysate (68.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.3 KDa).