You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293155 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EWSR1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 5C10 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | EWSR1 (NP_005234, 358 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS |
NCBI | NP_005234 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EWSR1 is approximately 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to EWSR1 on formalin-fixed paraffin-embedded human urinary bladder. [antibody concentration 3 ug/ml]
Western Blot analysis of EWSR1 expression in transfected 293T cell line by EWSR1 monoclonal antibody (M01), clone 5C10. Lane 1: EWSR1 transfected lysate (68.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.3 KDa).