EWSR1 Antibody (monoclonal, 4B4)

• Catalog Number: orb507560
• Category: Antibodies
• Description: EWSR1 Antibody (monoclonal, 4B4)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B4
• Tested applications: IHC, WB
• Reactivity: Human, Monkey, Mouse
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 95 kDa
• UniProt ID: Q01844
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: RNA-binding protein EWS; EWS oncogene; Ewing sarco
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB analysis of EWSR1 using anti-EWSR1 antibody.Lane 1:K562 cell; 2:Jurkat cell; 3:A549 cell; 4:MCF-7 cell; 5:COLO-320 cell; 6:SW620 cell; 7:A431 cell.

IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in paraffin-embedded section of mouse spleen tissue.