You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb507560 |
---|---|
Category | Antibodies |
Description | EWSR1 Antibody (monoclonal, 4B4) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4B4 |
Tested applications | IHC, WB |
Reactivity | Human, Monkey, Mouse |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 95 kDa |
UniProt ID | Q01844 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | RNA-binding protein EWS; EWS oncogene; Ewing sarco Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB analysis of EWSR1 using anti-EWSR1 antibody.Lane 1:K562 cell; 2:Jurkat cell; 3:A549 cell; 4:MCF-7 cell; 5:COLO-320 cell; 6:SW620 cell; 7:A431 cell.
IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in paraffin-embedded section of human placenta tissue.
IHC analysis of EWSR1 using anti-EWSR1 antibody. EWSR1 was detected in paraffin-embedded section of mouse spleen tissue.
Filter by Rating