EVX1 monoclonal antibody (M07), clone 1B7

• Catalog Number: orb2293156
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant EVX1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B7
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: EVX1 (NP_001980, 2 a.a. ~ 110 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQP*
• NCBI: NP_001980
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EVX1 monoclonal antibody (M07), clone 1B7 Western Blot analysis of EVX1 expression in HeLa.

EVX1 monoclonal antibody (M07), clone 1B7. Western Blot analysis of EVX1 expression in NIH/3T3.

EVX1 monoclonal antibody (M07), clone 1B7. Western Blot analysis of EVX1 expression in PC-12.

EVX1 monoclonal antibody (M07), clone 1B7. Western Blot analysis of EVX1 expression in Raw 264.7.

Western Blot detection against Immunogen (37.99 KDa).