ETV5 monoclonal antibody (M02), clone 7C10

• Catalog Number: orb2293160
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ETV5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7C10
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM
• NCBI: NP_004445
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ETV5 is approximately 0.03 ng/ml as a capture antibody.

ETV5 monoclonal antibody (M02), clone 7C10 Western Blot analysis of ETV5 expression in Hela S3 NE.

ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in NIH/3T3.

ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in PC-12.

ETV5 monoclonal antibody (M02), clone 7C10. Western Blot analysis of ETV5 expression in Raw 264.7.

Western Blot detection against Immunogen (37.84 KDa).