ETS1 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2293166
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ETS1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human, Mouse
• Immunogen: ETS1 (NP_005229.1, 1 a.a. ~ 441 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
• NCBI: NP_005229.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ETS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ETS1 expression in human spleen.

ETS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ETS1 expression in mouse intestine.

Proximity Ligation Analysis of protein-protein interactions between ETS1 and MAPK1. HeLa cells were stained with anti-ETS1 rabbit purified polyclonal 1:1200 and anti-MAPK1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of ETS1 expression in transfected 293T cell line by ETS1 MaxPab polyclonal antibody. Lane 1: ETS1 transfected lysate (50.40 KDa). Lane 2: Non-transfected lysate.