ETK Antibody (Phospho-Tyr40)

• Catalog Number: orb2240622
• Category: Antibodies
• Description: ETK Antibody (Phospho-Tyr40)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC, IHC-P, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from human ETK around the phosphorylation site of Tyr40.
• Conjugation: Unconjugated
• MW: 78 kDa
• UniProt ID: P51813
• Protein Sequence: Synthetic peptide located within the following region: ILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSI
• Storage: -20°C
• Alternative names: bone marrow tyrosine kinase gene in chromosome X p
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1:1000IHC: 1:50~1:100IF: 1:100~1:500ELISA: 1:40000
• Expiration Date: 12 months from date of receipt.