RBM35B Rabbit Polyclonal Antibody

• Catalog Number: orb576339
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBM35B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RBM35B
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 79kDa
• Target: Esrp2
• UniProt ID: Q8K0G8
• Protein Sequence: Synthetic peptide located within the following region: ' target='_blank'>EPRSRQVGTLHKSLVRAEAAALSPQCREASGLSADSLARAESLDKVLQQF
• NCBI: NP_789808
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Rbm35, Rbm35b, 9530027K23Rik
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-RBM35B Antibody Titration: 2.5 ug/ml, Positive Control: NIH/3T3 cell lysate.