ESM1 monoclonal antibody (M02), clone 6D4

• Catalog Number: orb2291446
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ESM1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ESM1 (NP_008967, 85 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 6D4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_008967

Detection limit for recombinant GST tagged ESM1 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to ESM1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 monoclonal antibody (M02), clone 6D4. Lane 1: ESM1 transfected lysate(20.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).