Cart summary

You have no items in your shopping cart.

    ERV31/ERV3-1 Antibody

    Catalog Number: orb316538

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb316538
    CategoryAntibodies
    DescriptionERV31/ERV3-1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW67942 MW
    UniProt IDQ14264
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesEndogenous retrovirus group 3 member 1 Env polypro
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    ERV31/ERV3-1 Antibody

    Western blot analysis using Anti-ERV31 antibody.Lane 1:HELA Cell;2:22RV1 Cell;3:HEPG2 Cell;4:SKOV Cell;5:A431 Cell;6:HT1080 Cell.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars