You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334504 |
---|---|
Category | Antibodies |
Description | ERp57/PDIA3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, IHC-Fr, WB |
Predicted Reactivity | Bovine |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 56782 MW |
UniProt ID | P30101 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Protein disulfide-isomerase A3;5.3.4.1;58 kDa gluc Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of PC-3 cells using anti-ERp57 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of ERp57 using anti-ERp57 antibody.Lane 1:Rat Liver Tissue;2:Mouse Liver Tissue;3:A549 Cell.
IF analysis of ERp57 using anti-ERp57 antibody. ERp57 was detected in immunocytochemical section of U20S cells.
IHC analysis of PB9771 using anti-PB9771 antibody. PB9771 was detected in paraffin-embedded section of Human Lung Cancer Tissue.
IHC analysis of ERp57 using anti-ERp57 antibody.ERp57 was detected in frozen section of human placenta tissue.
IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating