ERp57/PDIA3 Antibody

• Catalog Number: orb334504
• Category: Antibodies
• Description: ERp57/PDIA3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, IHC-Fr, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 56782 MW
• UniProt ID: P30101
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Protein disulfide-isomerase A3;5.3.4.1;58 kDa gluc
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-ERp57 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of ERp57 using anti-ERp57 antibody.Lane 1:Rat Liver Tissue;2:Mouse Liver Tissue;3:A549 Cell.

IF analysis of ERp57 using anti-ERp57 antibody. ERp57 was detected in immunocytochemical section of U20S cells.

IHC analysis of PB9771 using anti-PB9771 antibody. PB9771 was detected in paraffin-embedded section of Human Lung Cancer Tissue.

IHC analysis of ERp57 using anti-ERp57 antibody.ERp57 was detected in frozen section of human placenta tissue.