ERO1L polyclonal antibody (A01)

• Catalog Number: orb2291193
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant ERO1L.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Immunogen: ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
• NCBI: NP_055399
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ERO1L polyclonal antibody (A01), Western Blot analysis of ERO1L expression in A-431.

ERO1L polyclonal antibody (A01), Western Blot analysis of ERO1L expression in NIH/3T3.

ERO1L polyclonal antibody (A01), Western Blot analysis of ERO1L expression in PC-12.

ERO1L polyclonal antibody (A01), Western Blot analysis of ERO1L expression in Raw 264.7.

Western Blot detection against Immunogen (35.9 KDa).