ERO1L monoclonal antibody (M01), clone 4G3

• Catalog Number: orb2291192
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ERO1L.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G3
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY
• NCBI: NP_055399
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ERO1L is approximately 3 ng/ml as a capture antibody.

ERO1L monoclonal antibody (M01), clone 4G3 Western Blot analysis of ERO1L expression in HeLa.

ERO1L monoclonal antibody (M01), clone 4G3. Western Blot analysis of ERO1L expression in PC-12.

Immunoperoxidase of monoclonal antibody to ERO1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]

Western Blot analysis of ERO1L expression in transfected 293T cell line by ERO1L monoclonal antibody (M01), clone 4G3. Lane 1: ERO1L transfected lysate(54 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).