ERH monoclonal antibody (M14), clone 4A10

• Catalog Number: orb2293182
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ERH.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ERH (AAH14301, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 4A10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH14301

Detection limit for recombinant GST tagged ERH is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ERH on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ERH on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]

Western Blot analysis of ERH expression in transfected 293T cell line by ERH monoclonal antibody (M14), clone 4A10. Lane 1: ERH transfected lysate (12.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.18 KDa).