ERF monoclonal antibody (M02), clone 3F11

• Catalog Number: orb2293184
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ERF.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F11
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse
• Isotype: IgG2b Kappa
• Immunogen: ERF (AAH22231, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG
• NCBI: AAH22231
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ERF monoclonal antibody (M02), clone 3F11. Western Blot analysis of ERF expression in Raw 264.7.

Immunofluorescence of monoclonal antibody to ERF on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (37.73 KDa).