ERBB2 monoclonal antibody (M05), clone 3B1

• Catalog Number: orb2293195
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ERBB2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
• Tested applications: ELISA, IF, IHC-P, PLA, WB
• Clone Number: 3B1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004439
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ERBB2 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ERBB2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunofluorescence of monoclonal antibody to ERBB2 on MCF-7 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ERBB2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]

Proximity Ligation Analysis of protein-protein interactions between ERBB3 and ERBB2. HeLa cells were stained with anti-ERBB3 rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).