You have no items in your shopping cart.
Cart summary
ERAP1 Recombinant Protein (Mouse)
Catalog Number: orb2052141
| Catalog Number | orb2052141 |
|---|---|
| Category | Proteins |
| Description | ERAP1 Recombinant Protein (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 28.3 kDa |
| UniProt ID | Q9EQH2 |
| Protein Sequence | PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL |
| Source | E.coli |
| NCBI | NP_109636 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | adipocyte-derived leucine aminopeptidase;A-LAP;ami Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Erap1 protein [orb54182]
Greater than 90% as determined by SDS-PAGE.
28.3 kDa
E.coli
20 μg, 100 μg, 1 mgERAP1 Recombinant Protein (Mouse) [orb2052140]
Greater than 90% as determined by SDS-PAGE.
28.3 kDa
E.coli
20 μgERAP1 Recombinant Protein (Mouse) [orb2052142]
Greater than 90% as determined by SDS-PAGE.
28.3 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
