EPM2AIP1 monoclonal antibody (M01), clone 3H7

• Catalog Number: orb2291664
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H7
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b Kappa
• Immunogen: EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN
• NCBI: NP_055620
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EPM2AIP1 is approximately 0.03 ng/ml as a capture antibody.

EPM2AIP1 monoclonal antibody (M01), clone 3H7 Western Blot analysis of EPM2AIP1 expression in HeLa.

EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in NIH/3T3.

EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in PC-12.

EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in Raw 264.7.

Western Blot detection against Immunogen (36.63 KDa).