You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291664 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EPM2AIP1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3H7 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2b Kappa |
Immunogen | EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN |
NCBI | NP_055620 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EPM2AIP1 is approximately 0.03 ng/ml as a capture antibody.
EPM2AIP1 monoclonal antibody (M01), clone 3H7 Western Blot analysis of EPM2AIP1 expression in HeLa.
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in NIH/3T3.
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in PC-12.
EPM2AIP1 monoclonal antibody (M01), clone 3H7. Western Blot analysis of EPM2AIP1 expression in Raw 264.7.
Western Blot detection against Immunogen (36.63 KDa).