epithelial Sodium Channel alpha/SCNN1A Antibody

• Catalog Number: orb413054
• Category: Antibodies
• Description: epithelial Sodium Channel alpha/SCNN1A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SCNN1A (QEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunocytochemistry/ Immunofluorescence, 2μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 76 kDa
• UniProt ID: P37088
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Amiloride-sensitive sodium channel subunit alpha;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SCNN1A using anti-SCNN1A antibody.Lane 1:human COLO-320 cell;2:human HepG2 cell;3:human A549 cell.

IF analysis of SCNN1A using anti-SCNN1A antibody.SCNN1A was detected in immunocytochemical section of A431 cell.

IF analysis of SCNN1A using anti-SCNN1A antibody.SCNN1A was detected in immunocytochemical section of A431 cell.