EPHX2 Antibody

• Catalog Number: orb389402
• Category: Antibodies
• Description: EPHX2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 62616 MW
• UniProt ID: P34913
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Bifunctional epoxide hydrolase 2;Cytosolic epoxide
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-EPHX2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of EPHX2 using anti-EPHX2 antibody.Lane 1:human HepG2 cell; 2:rat liver tissue; 3:rat kidney tissue; 4:mouse liver tissue; 5:mouse kidney tissue.