EPHB6 monoclonal antibody (M03), clone 5D8

• Catalog Number: orb2293207
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHB6.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EPHB6 (NP_004436, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 5D8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004436

Detection limit for recombinant GST tagged EPHB6 is approximately 0.3 ng/ml as a capture antibody.

EPHB6 monoclonal antibody (M03), clone 5D8 Western Blot analysis of EPHB6 expression in PC-12.

EPHB6 monoclonal antibody (M03), clone 5D8. Western Blot analysis of EPHB6 expression in NIH/3T3.

Immunoperoxidase of monoclonal antibody to EPHB6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.63 KDa).