EPHB3 monoclonal antibody (M01), clone 1B3

• Catalog Number: orb2293212
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHB3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 1B3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004434

Detection limit for recombinant GST tagged EPHB3 is approximately 0.1 ng/ml as a capture antibody.

EPHB3 monoclonal antibody (M01), clone 1B3 Western Blot analysis of EPHB3 expression in HeLa.

Immunoperoxidase of monoclonal antibody to EPHB3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot analysis of EPHB3 expression in transfected 293T cell line by EPHB3 monoclonal antibody (M01), clone 1B3. Lane 1: EPHB3 transfected lysate (110.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).